Ceramide synthase 2 (CERS2) (NM_022075) Human Mass Spec Standard
CAT#: PH300145
LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358)
View other "Ceramide synthase 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200145 |
Predicted MW | 44.9 kDa |
Protein Sequence |
>RC200145 protein sequence
Red=Cloning site Green=Tags(s) MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE GEEAAAGGGAKSRPLANGHPILNNNHRKND myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071358 |
RefSeq Size | 2504 |
RefSeq ORF | 1140 |
Synonyms | L3; LASS2; SP260; TMSG1 |
Locus ID | 29956 |
Cytogenetics | 1q21.3 |
Summary | This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405622 | CERS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411798 | CERS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405622 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 |
CNY 3,080.00 |
|
LY411798 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 |
CNY 3,080.00 |
|
PH315300 | LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_859530) |
CNY 19,520.00 |
|
TP300145 | Purified recombinant protein of Homo sapiens LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315300 | Recombinant protein of human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Ceramide synthase 2产品