United States
Germany
Japan
United Kingdom
China
Gemin 8 (GEMIN8) (NM_001042479) Human Mass Spec Standard
CAT＃: PH300165
GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035944)
View other "Gemin 8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035944) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200165 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC200165 protein sequence
Red=Cloning site Green=Tags(s) MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035944 |
| RefSeq Size | 3171 |
| RefSeq ORF | 726 |
| Synonyms | FAM51A1 |
| Locus ID | 54960 |
| Cytogenetics | Xp22.2 |
| Summary | The protein encoded by this gene is part of the SMN complex, which is necessary for spliceosomal snRNP assembly in the cytoplasm and pre-mRNA splicing in the nucleus. The encoded protein binds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediating their interaction. This protein is found in nuclear Gemini of Cajal bodies (gems) and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413420 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420932 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420933 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413420 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3 |
CNY 3,080.00 |
|
| LY420932 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2 |
CNY 3,080.00 |
|
| LY420933 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1 |
CNY 3,080.00 |
|
| PH304795 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035945) |
CNY 19,520.00 |
|
| PH313444 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_060326) |
CNY 19,520.00 |
|
| TP300165 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP304795 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313444 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Gemin 8产品
