CHCHD3 (NM_017812) Human Mass Spec Standard
CAT#: PH300174
CHCHD3 MS Standard C13 and N15-labeled recombinant protein (NP_060282)
View other "CHCHD3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CHCHD3 MS Standard C13 and N15-labeled recombinant protein (NP_060282) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200174 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC200174 protein sequence
Red=Cloning site Green=Tags(s) MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEEL ALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAF YKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQ YMHCVNHAKQSMLEKGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060282 |
RefSeq Size | 1622 |
RefSeq ORF | 681 |
Synonyms | Mic19; MICOS19; MINOS3; PPP1R22 |
Locus ID | 54927 |
Cytogenetics | 7q32.3-q33 |
Summary | The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption. This protein is part of the mitochondrial contact site and cristae organizing system (MICOS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413521 | CHCHD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413521 | Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 3 (CHCHD3) |
CNY 3,080.00 |
|
TP300174 | Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 3 (CHCHD3), 20 µg |
CNY 2,900.00 |