14-3-3 epsilon (YWHAE) (NM_006761) Human Mass Spec Standard
CAT#: PH300245
YWHAE MS Standard C13 and N15-labeled recombinant protein (NP_006752)
View other "14-3-3 epsilon" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | YWHAE MS Standard C13 and N15-labeled recombinant protein (NP_006752) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200245 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC200245 protein sequence
Red=Cloning site Green=Tags(s) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006752 |
RefSeq Size | 1827 |
RefSeq ORF | 765 |
Synonyms | 14-3-3E; HEL2; KCIP-1; MDCR; MDS |
Locus ID | 7531 |
Cytogenetics | 17p13.3 |
Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402021 | YWHAE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402021 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
CNY 3,080.00 |
|
TP300245 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720511 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
CNY 3,140.00 |
其它14-3-3 epsilon产品