UGP2 (NM_001001521) Human Mass Spec Standard
CAT#: PH300246
UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_001001521)
View other "UGP2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_001001521) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200246 |
Predicted MW | 55.7 kDa |
Protein Sequence |
>RC200246 protein sequence
Red=Cloning site Green=Tags(s) MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRP PEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNK TYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPP GHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVK GGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDG GLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK LGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSG NLRILDH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001521 |
RefSeq Size | 2129 |
RefSeq ORF | 1491 |
Synonyms | DEE83; EIEE83; pHC379; SVUGP2; UDPG; UDPGP; UDPGP2; UGP1; UGPP1; UGPP2 |
Locus ID | 7360 |
Cytogenetics | 2p15 |
Summary | The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416438 | UGP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424368 | UGP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416438 | Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1 |
CNY 3,080.00 |
|
LY424368 | Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2 |
CNY 3,080.00 |
|
PH308376 | UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_006750) |
CNY 19,520.00 |
|
TP300246 | Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP308376 | Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 20 µg |
CNY 2,900.00 |