United States
Germany
Japan
United Kingdom
China
MSF (SEPT9) (NM_006640) Human Mass Spec Standard
CAT＃: PH300264
SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631)
View other "MSF" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200264 |
| Predicted MW | 63.6 kDa |
| Protein Sequence |
>RC200264 protein sequence
Red=Cloning site Green=Tags(s) MERDRISALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKA SLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQ ESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQ PPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFE FNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGD HINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVN IVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQV NGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGVEE KEPEAPEM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006631 |
| RefSeq Size | 4469 |
| RefSeq ORF | 1704 |
| Synonyms | AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1 |
| Locus ID | 10801 |
| Cytogenetics | 17q25.3 |
| Summary | This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401986 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426417 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426419 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426421 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426422 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401986 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 3 |
CNY 3,080.00 |
|
| LY426417 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 1 |
CNY 3,080.00 |
|
| LY426419 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 2 |
CNY 3,080.00 |
|
| LY426421 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 4 |
CNY 3,080.00 |
|
| LY426422 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 7 |
CNY 3,080.00 |
|
| PH325490 | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968) |
CNY 14,250.00 |
|
| TP300264 | Recombinant protein of human septin 9 (SEPT9), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325490 | Purified recombinant protein of Homo sapiens septin 9 (SEPT9), transcript variant 7, 20 µg |
CNY 2,900.00 |
