Rab2 (RAB2A) (NM_002865) Human Mass Spec Standard
CAT#: PH300433
RAB2A MS Standard C13 and N15-labeled recombinant protein (NP_002856)
View other "Rab2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB2A MS Standard C13 and N15-labeled recombinant protein (NP_002856) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200433 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC200433 protein sequence
Red=Cloning site Green=Tags(s) MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG CC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002856 |
RefSeq Size | 3812 |
RefSeq ORF | 636 |
Synonyms | LHX; RAB2 |
Locus ID | 5862 |
Cytogenetics | 8q12.1-q12.2 |
Summary | The protein encoded by this gene belongs to the Rab family, members of which are small molecular weight guanosine triphosphatases (GTPases) that contain highly conserved domains involved in GTP binding and hydrolysis. The Rabs are membrane-bound proteins, involved in vesicular fusion and trafficking. This protein is a resident of pre-Golgi intermediates, and is required for protein transport from the endoplasmic reticulum (ER) to the Golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419058 | RAB2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419058 | Transient overexpression lysate of RAB2A, member RAS oncogene family (RAB2A) |
CNY 3,080.00 |
|
TP300433 | Recombinant protein of human RAB2A, member RAS oncogene family (RAB2A), 20 µg |
CNY 2,900.00 |