ERCC1 (NM_001983) Human Mass Spec Standard
CAT#: PH300478
ERCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001974)
View other "ERCC1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ERCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001974) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200478 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC200478 protein sequence
Red=Cloning site Green=Tags(s) MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLE GAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALF LSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE TYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQ KARRLFDVLHEPFLKVP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001974 |
RefSeq Size | 3400 |
RefSeq ORF | 891 |
Synonyms | COFS4; RAD10; UV20 |
Locus ID | 2067 |
Cytogenetics | 19q13.32 |
Summary | The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404356 | ERCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419605 | ERCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404356 | Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 1 |
CNY 3,080.00 |
|
LY419605 | Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 2 |
CNY 3,080.00 |
|
PH308787 | ERCC1 MS Standard C13 and N15-labeled recombinant protein (NP_973730) |
CNY 19,520.00 |
|
TP300478 | Recombinant protein of human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP308787 | Recombinant protein of human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 1, 20 µg |
CNY 2,900.00 |