Synaptogyrin 1 (SYNGR1) (NM_145731) Human Mass Spec Standard
CAT#: PH300562
SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783)
View other "Synaptogyrin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200562 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC200562 protein sequence
Red=Cloning site Green=Tags(s) MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL NEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_663783 |
RefSeq Size | 1341 |
RefSeq ORF | 573 |
Locus ID | 9145 |
Cytogenetics | 22q13.1 |
Summary | This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407866 | SYNGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407866 | Transient overexpression lysate of synaptogyrin 1 (SYNGR1), transcript variant 1b |
CNY 3,080.00 |
|
TP300562 | Recombinant protein of human synaptogyrin 1 (SYNGR1), transcript variant 1b, 20 µg |
CNY 2,900.00 |
其它Synaptogyrin 1产品