RNase H1 (RNASEH1) (NM_002936) Human Mass Spec Standard
CAT#: PH300595
RNASEH1 MS Standard C13 and N15-labeled recombinant protein (NP_002927)
View other "RNase H1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RNASEH1 MS Standard C13 and N15-labeled recombinant protein (NP_002927) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200595 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC200595 protein sequence
Red=Cloning site Green=Tags(s) MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF VRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG AKQSED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002927 |
RefSeq Size | 1865 |
RefSeq ORF | 858 |
Synonyms | H1RNA; PEOB2; RNH1 |
Locus ID | 246243 |
Cytogenetics | 2p25.3 |
Summary | This gene encodes an endonuclease that specifically degrades the RNA of RNA-DNA hybrids and plays a key role in DNA replication and repair. Alternate in-frame start codon initiation results in the production of alternate isoforms that are directed to the mitochondria or to the nucleus. The production of the mitochondrial isoform is modulated by an upstream open reading frame (uORF). Mutations in this gene have been found in individuals with progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 2. Alternative splicing results in additional coding and non-coding transcript variants. Pseudogenes of this gene have been defined on chromosomes 2 and 17. [provided by RefSeq, Jul 2017] |
Protein Pathways | DNA replication |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401027 | RNASEH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401027 | Transient overexpression lysate of ribonuclease H1 (RNASEH1) |
CNY 3,080.00 |
|
TP300595 | Recombinant protein of human ribonuclease H1 (RNASEH1), 20 µg |
CNY 2,900.00 |
其它RNase H1产品