SERPINB6 (NM_004568) Human Mass Spec Standard
CAT#: PH300668
SERPINB6 MS Standard C13 and N15-labeled recombinant protein (NP_004559)
View other "SERPINB6" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SERPINB6 MS Standard C13 and N15-labeled recombinant protein (NP_004559) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200668 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC200668 representing NM_004568
Red=Cloning site Green=Tags(s) MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC ADHPFLFFIQHSKTNGILFCGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004559 |
RefSeq Size | 1665 |
RefSeq ORF | 1128 |
Synonyms | CAP; DFNB91; MSTP057; PI-6; PI6; PTI; SPI3 |
Locus ID | 5269 |
Cytogenetics | 6p25.2 |
Summary | The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417897 | SERPINB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417897 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) |
CNY 3,080.00 |
|
TP300668 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6), 20 µg |
CNY 2,900.00 |
|
TP720554 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) |
CNY 3,140.00 |
其它SERPINB6产品