IFNGR2 (NM_005534) Human Mass Spec Standard
CAT#: PH300674
IFNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_005525)
View other "IFNGR2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | IFNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_005525) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200674 |
Predicted MW | 37.81 kDa |
Protein Sequence |
>RC200674 representing NM_005534
Red=Cloning site Green=Tags(s) MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005525 |
RefSeq Size | 2219 |
RefSeq ORF | 1011 |
Synonyms | AF-1; IFGR2; IFNGT1; IMD28 |
Locus ID | 3460 |
Cytogenetics | 21q22.11 |
Summary | This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401697 | IFNGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401697 | Transient overexpression lysate of interferon gamma receptor 2 (interferon gamma transducer 1) (IFNGR2) |
CNY 3,080.00 |
|
TP300674 | Recombinant protein of human interferon gamma receptor 2 (interferon gamma transducer 1) (IFNGR2), 20 µg |
CNY 2,900.00 |