UBXN1 (NM_015853) Human Mass Spec Standard
CAT#: PH300703
UBXN1 MS Standard C13 and N15-labeled recombinant protein (NP_056937)
View other "UBXN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UBXN1 MS Standard C13 and N15-labeled recombinant protein (NP_056937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200703 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC200703 protein sequence
Red=Cloning site Green=Tags(s) MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQE DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKRE YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQE LGMAARLETRTRNWGSREACLGKGGMQREGAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056937 |
RefSeq Size | 1363 |
RefSeq ORF | 936 |
Synonyms | 2B28; SAKS1; UBXD10 |
Locus ID | 51035 |
Cytogenetics | 11q12.3 |
Summary | Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling (PubMed:23545497). Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1 (PubMed:25681446). Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B (PubMed:28152074). Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer (PubMed:20351172). Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402462 | UBXN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402462 | Transient overexpression lysate of UBX domain protein 1 (UBXN1) |
CNY 3,080.00 |
|
TP300703 | Recombinant protein of human UBX domain protein 1 (UBXN1), 20 µg |
CNY 2,900.00 |