Thyroid Hormone Receptor alpha (THRA) (NM_003250) Human Mass Spec Standard
CAT#: PH300735
THRA MS Standard C13 and N15-labeled recombinant protein (NP_003241)
View other "Thyroid Hormone Receptor alpha" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | THRA MS Standard C13 and N15-labeled recombinant protein (NP_003241) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200735 |
Predicted MW | 54.8 kDa |
Protein Sequence |
>RC200735 protein sequence
Red=Cloning site Green=Tags(s) MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITC EGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQ NRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKV DLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEM AVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFE HYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAASP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003241 |
RefSeq Size | 2566 |
RefSeq ORF | 1470 |
Synonyms | AR7; c-ERBA-1; CHNG6; EAR7; ERB-T-1; ERBA; ERBA1; NR1A1; THRA1; THRA2; TRalpha |
Locus ID | 7067 |
Cytogenetics | 17q21.1 |
Summary | The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418803 | THRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418803 | Transient overexpression lysate of thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) (THRA), transcript variant 2 |
CNY 3,080.00 |
|
TP300735 | Recombinant protein of human thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) (THRA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710024 | Recombinant protein of human thyroid hormone receptor,alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) (THRA),full length,with C-terminal DDK tag,expressed in sf9 cells. |
CNY 4,020.00 |
其它Thyroid Hormone Receptor alpha产品