SOX2 (NM_003106) Human Mass Spec Standard
CAT#: PH300757
SOX2 MS Standard C13 and N15-labeled recombinant protein (NP_003097)
View other "SOX2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOX2 MS Standard C13 and N15-labeled recombinant protein (NP_003097) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200757 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC200757 protein sequence
Red=Cloning site Green=Tags(s) MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003097 |
RefSeq Size | 2520 |
RefSeq ORF | 951 |
Synonyms | ANOP3; MCOPS3 |
Locus ID | 6657 |
Cytogenetics | 3q26.33 |
Summary | This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Cancer stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401083 | SOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401083 | Transient overexpression lysate of SRY (sex determining region Y)-box 2 (SOX2) |
CNY 3,080.00 |
|
TP300757 | Recombinant protein of human SRY (sex determining region Y)-box 2 (SOX2), 20 µg |
CNY 2,900.00 |