HIC5 (TGFB1I1) (NM_015927) Human Mass Spec Standard
CAT#: PH300761
TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011)
View other "HIC5" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200761 |
Predicted MW | 47.9 kDa |
Protein Sequence |
>RC200761 protein sequence
Red=Cloning site Green=Tags(s) MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP LTKGSFQERAGKPYCQPCFLKLFG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057011 |
RefSeq Size | 1812 |
RefSeq ORF | 1332 |
Synonyms | ARA55; HIC-5; HIC5; TSC-5 |
Locus ID | 7041 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402475 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431927 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402475 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 |
CNY 3,080.00 |
|
LY431927 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3 |
CNY 3,080.00 |
|
TP300761 | Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP328899 | Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3, 20 µg |
CNY 2,900.00 |