RAMAC (NM_031452) Human Mass Spec Standard
CAT#: PH300815
FAM103A1 MS Standard C13 and N15-labeled recombinant protein (NP_113640)
View other "RAMAC" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | FAM103A1 MS Standard C13 and N15-labeled recombinant protein (NP_113640) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200815 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC200815 protein sequence
Red=Cloning site Green=Tags(s) MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_113640 |
RefSeq Size | 1588 |
RefSeq ORF | 354 |
Synonyms | C15orf18; FAM103A1; HsT19360; RAM; RAMMET |
Locus ID | 83640 |
Cytogenetics | 15q25.2 |
Summary | Regulatory subunit of the mRNA-capping methyltransferase RNMT:RAMAC complex that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs (PubMed:22099306, PubMed:27422871). Promotes the recruitment of the methyl donor, S-adenosyl-L-methionine, to RNMT (PubMed:27422871). Regulates RNMT expression by a post-transcriptional stabilizing mechanism (PubMed:22099306). Binds RNA (PubMed:22099306).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410524 | FAM103A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410524 | Transient overexpression lysate of family with sequence similarity 103, member A1 (FAM103A1) |
CNY 3,080.00 |
|
TP300815 | Recombinant protein of human family with sequence similarity 103, member A1 (FAM103A1), 20 µg |
CNY 2,900.00 |