United States
Germany
Japan
United Kingdom
China
PUS1 (NM_025215) Human Mass Spec Standard
CAT＃: PH300879
PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491)
View other "PUS1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200879 |
| Predicted MW | 47.5 kDa |
| Protein Sequence |
>RC200879 protein sequence
Red=Cloning site Green=Tags(s) MGLQLRALLGAFGRWTLRLGPRPSCSPRMAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLK SGGDEERREKPPKRKIVLLMAYSGKGYHGMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQ RCARTDKGVSAAGQVVSLKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAF AHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFA VIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGND GLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGS EGDGDTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079491 |
| RefSeq Size | 2014 |
| RefSeq ORF | 1281 |
| Synonyms | MLASA1 |
| Locus ID | 80324 |
| Cytogenetics | 12q24.33 |
| Summary | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410839 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424322 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424323 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410839 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 |
CNY 3,080.00 |
|
| LY424322 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 |
CNY 3,080.00 |
|
| LY424323 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
CNY 3,080.00 |
|
| PH302637 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002019) |
CNY 19,520.00 |
|
| PH322753 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020) |
CNY 19,520.00 |
|
| TP300879 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP302637 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP322753 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3, 20 µg |
CNY 2,900.00 |
