SSU72 (NM_014188) Human Mass Spec Standard
CAT#: PH300900
SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907)
View other "SSU72" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200900 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC200900 protein sequence
Red=Cloning site Green=Tags(s) MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054907 |
RefSeq Size | 1319 |
RefSeq ORF | 582 |
Synonyms | HSPC182; PNAS-120 |
Locus ID | 29101 |
Cytogenetics | 1p36.33 |
Summary | Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415450 | SSU72 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415450 | Transient overexpression lysate of SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72) |
CNY 3,080.00 |
|
TP300900 | Recombinant protein of human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), 20 µg |
CNY 2,900.00 |