RhoGDI (ARHGDIA) (NM_004309) Human Mass Spec Standard
CAT#: PH300902
ARHGDIA MS Standard C13 and N15-labeled recombinant protein (NP_004300)
View other "RhoGDI" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ARHGDIA MS Standard C13 and N15-labeled recombinant protein (NP_004300) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200902 |
Predicted MW | 23.2 kDa |
Protein Sequence |
>RC200902 protein sequence
Red=Cloning site Green=Tags(s) MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004300 |
RefSeq Size | 1920 |
RefSeq ORF | 612 |
Synonyms | GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1 |
Locus ID | 396 |
Cytogenetics | 17q25.3 |
Summary | This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401371 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434003 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401371 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) |
CNY 3,080.00 |
|
LY434003 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3 |
CNY 3,080.00 |
|
TP300902 | Recombinant protein of human Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), 20 µg |
CNY 2,900.00 |
|
TP331004 | Purified recombinant protein of Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3, 20 µg |
CNY 2,900.00 |