NUDT21 (NM_007006) Human Mass Spec Standard
CAT#: PH300936
NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937)
View other "NUDT21" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200936 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC200936 protein sequence
Red=Cloning site Green=Tags(s) MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP IISSLPQLLSRFNFIYN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008937 |
RefSeq Size | 4407 |
RefSeq ORF | 681 |
Synonyms | CFIM25; CPSF5 |
Locus ID | 11051 |
Cytogenetics | 16q13 |
Summary | The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416262 | NUDT21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416262 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21) |
CNY 3,080.00 |
|
TP300936 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), 20 µg |
CNY 2,900.00 |