NTAQ1 (NM_018024) Human Mass Spec Standard
CAT#: PH301055
WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494)
View other "NTAQ1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201055 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC201055 protein sequence
Red=Cloning site Green=Tags(s) MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQAR PGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLK NFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060494 |
RefSeq Size | 1568 |
RefSeq ORF | 615 |
Synonyms | C8orf32; WDYHV1 |
Locus ID | 55093 |
Cytogenetics | 8q24.13 |
Summary | Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. Does not deaminate acetylated N-terminal glutamine. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine.[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402638 | WDYHV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402638 | Transient overexpression lysate of WDYHV motif containing 1 (WDYHV1) |
CNY 3,080.00 |
|
TP301055 | Recombinant protein of human WDYHV motif containing 1 (WDYHV1), 20 µg |
CNY 2,900.00 |