TOMM34 (NM_006809) Human Mass Spec Standard
CAT#: PH301083
TOMM34 MS Standard C13 and N15-labeled recombinant protein (NP_006800)
View other "TOMM34" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TOMM34 MS Standard C13 and N15-labeled recombinant protein (NP_006800) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201083 |
Predicted MW | 34.6 kDa |
Protein Sequence |
>RC201083 protein sequence
Red=Cloning site Green=Tags(s) MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS FADISNLLQIEPRNGPAQKLRQEVKQNLH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006800 |
RefSeq Size | 2066 |
RefSeq ORF | 927 |
Synonyms | HTOM34P; TOM34; URCC3 |
Locus ID | 10953 |
Cytogenetics | 20q13.12 |
Summary | The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416405 | TOMM34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416405 | Transient overexpression lysate of translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP301083 | Recombinant protein of human translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |