PEX16 (NM_004813) Human Mass Spec Standard
CAT#: PH301115
PEX16 MS Standard C13 and N15-labeled recombinant protein (NP_004804)
View other "PEX16" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PEX16 MS Standard C13 and N15-labeled recombinant protein (NP_004804) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201115 |
Predicted MW | 38.6 kDa |
Protein Sequence |
>RC201115 protein sequence
Red=Cloning site Green=Tags(s) MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELR KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMLLLLWFKAGLQTSPP IVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATP TPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTIL LLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004804 |
RefSeq Size | 1929 |
RefSeq ORF | 1008 |
Synonyms | PBD8A; PBD8B |
Locus ID | 9409 |
Cytogenetics | 11p11.2 |
Summary | The protein encoded by this gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product morphologically and biochemically restores the formation of new peroxisomes, suggesting a role in peroxisome organization and biogenesis. Alternative splicing has been observed for this gene and two variants have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409272 | PEX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417729 | PEX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409272 | Transient overexpression lysate of peroxisomal biogenesis factor 16 (PEX16), transcript variant 2 |
CNY 3,080.00 |
|
LY417729 | Transient overexpression lysate of peroxisomal biogenesis factor 16 (PEX16), transcript variant 1 |
CNY 3,080.00 |
|
TP301115 | Recombinant protein of human peroxisomal biogenesis factor 16 (PEX16), transcript variant 1, 20 µg |
CNY 2,900.00 |