Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Mass Spec Standard
CAT#: PH301211
SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159)
View other "Suppressor of Ty 4 homolog 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201211 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC201211 protein sequence
Red=Cloning site Green=Tags(s) MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003159 |
RefSeq Size | 1545 |
RefSeq ORF | 351 |
Synonyms | SPT4; SPT4H; Supt4a; SUPT4H |
Locus ID | 6827 |
Cytogenetics | 17q22 |
Summary | This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418857 | SUPT4H1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418857 | Transient overexpression lysate of suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1) |
CNY 3,080.00 |
|
TP301211 | Recombinant protein of human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), 20 µg |
CNY 2,900.00 |
其它Suppressor of Ty 4 homolog 1产品