United States
Germany
Japan
United Kingdom
China
SSH3BP1 (ABI1) (NM_001012752) Human Mass Spec Standard
CAT＃: PH301264
ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_001012770)
View other "SSH3BP1" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_001012770) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201264 |
| Predicted MW | 51.8 kDa |
| Protein Sequence |
>RC201264 protein sequence
Red=Cloning site Green=Tags(s) MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP IDYTVLDDVGHGVKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMT SPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYG TMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFV ARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVV AIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012770 |
| RefSeq Size | 3629 |
| RefSeq ORF | 1428 |
| Synonyms | ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1 |
| Locus ID | 10006 |
| Cytogenetics | 10p12.1 |
| Summary | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401677 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422826 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422828 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432894 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433150 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433176 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401677 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 1 |
CNY 4,840.00 |
|
| LY422826 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 2 |
CNY 4,840.00 |
|
| LY422828 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 4 |
CNY 3,080.00 |
|
| LY432894 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 12 |
CNY 3,080.00 |
|
| LY433150 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 6 |
CNY 3,080.00 |
|
| LY433176 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 5 |
CNY 3,080.00 |
|
| PH317707 | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_005461) |
CNY 19,520.00 |
|
| TP301264 | Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP317707 | Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP329894 | Purified recombinant protein of Homo sapiens abl-interactor 1 (ABI1), transcript variant 12, 20 µg |
CNY 2,900.00 |
其它SSH3BP1产品
