Bcl x (BCL2L1) (NM_138578) Human Mass Spec Standard
CAT#: PH301314
BCL2L1 MS Standard C13 and N15-labeled recombinant protein (NP_612815)
View other "Bcl x" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | BCL2L1 MS Standard C13 and N15-labeled recombinant protein (NP_612815) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201314 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC201314 protein sequence
Red=Cloning site Green=Tags(s) MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF NRWFLTGMTVAGVVLLGSLFSRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612815 |
RefSeq Size | 2575 |
RefSeq ORF | 699 |
Synonyms | Bcl-X; BCL-XL/S; BCL2L; BCLX; PPP1R52 |
Locus ID | 598 |
Cytogenetics | 20q11.21 |
Summary | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403363 | BCL2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420078 | BCL2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403363 | Transient overexpression lysate of BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY420078 | Transient overexpression lysate of BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
TP301314 | Recombinant protein of human BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |