CHMP2B (NM_014043) Human Mass Spec Standard
CAT#: PH301532
CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762)
View other "CHMP2B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201532 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC201532 representing NM_014043
Red=Cloning site Green=Tags(s) MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL GVD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054762 |
RefSeq Size | 2410 |
RefSeq ORF | 639 |
Synonyms | ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B |
Locus ID | 25978 |
Cytogenetics | 3p11.2 |
Summary | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415517 | CHMP2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415517 | Transient overexpression lysate of chromatin modifying protein 2B (CHMP2B) |
CNY 3,080.00 |
|
TP301532 | Recombinant protein of human chromatin modifying protein 2B (CHMP2B), 20 µg |
CNY 2,900.00 |