NDUFA5 (NM_005000) Human Mass Spec Standard
CAT#: PH301539
NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991)
View other "NDUFA5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201539 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC201539 protein sequence
Red=Cloning site Green=Tags(s) MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004991 |
RefSeq Size | 5602 |
RefSeq ORF | 348 |
Synonyms | B13; CI-13kB; CI-13KD-B; NUFM; UQOR13 |
Locus ID | 4698 |
Cytogenetics | 7q31.32 |
Summary | This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417602 | NDUFA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417602 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP301539 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |