SH3 containing Grb 2 like 1 protein (SH3GL1) (NM_003025) Human Mass Spec Standard
CAT#: PH301552
SH3GL1 MS Standard C13 and N15-labeled recombinant protein (NP_003016)
View other "SH3 containing Grb 2 like 1 protein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SH3GL1 MS Standard C13 and N15-labeled recombinant protein (NP_003016) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201552 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC201552 protein sequence
Red=Cloning site Green=Tags(s) MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIE QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG QSGFFPLSYVEVLVPLPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003016 |
RefSeq Size | 2559 |
RefSeq ORF | 1104 |
Synonyms | CNSA1; EEN; SH3D2B; SH3P8 |
Locus ID | 6455 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418946 | SH3GL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418946 | Transient overexpression lysate of SH3-domain GRB2-like 1 (SH3GL1) |
CNY 3,080.00 |
|
TP301552 | Recombinant protein of human SH3-domain GRB2-like 1 (SH3GL1), 20 µg |
CNY 2,900.00 |
其它SH3 containing Grb 2 like 1 protein产品