ELAVL1 (NM_001419) Human Mass Spec Standard
CAT#: PH301562
ELAVL1 MS Standard C13 and N15-labeled recombinant protein (NP_001410)
View other "ELAVL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ELAVL1 MS Standard C13 and N15-labeled recombinant protein (NP_001410) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201562 |
Predicted MW | 36.1 kDa |
Protein Sequence |
>RC201562 protein sequence
Red=Cloning site Green=Tags(s) MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001410 |
RefSeq Size | 6075 |
RefSeq ORF | 978 |
Synonyms | ELAV1; Hua; HUR; MelG |
Locus ID | 1994 |
Cytogenetics | 19p13.2 |
Summary | The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400549 | ELAVL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400549 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) |
CNY 3,080.00 |
|
TP301562 | Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), 20 µg |
CNY 2,900.00 |