CENPA (NM_001042426) Human Mass Spec Standard
CAT#: PH301602
CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891)
View other "CENPA" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201602 |
Predicted MW | 13 kDa |
Protein Sequence |
>RC201602 protein sequence
Red=Cloning site Green=Tags(s) MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035891 |
RefSeq Size | 1352 |
RefSeq ORF | 342 |
Synonyms | CenH3; CENP-A |
Locus ID | 1058 |
Cytogenetics | 2p23.3 |
Summary | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400687 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420896 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400687 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 1 |
CNY 3,080.00 |
|
LY420896 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 2 |
CNY 3,080.00 |
|
PH324761 | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001800) |
CNY 19,520.00 |
|
TP301602 | Recombinant protein of human centromere protein A (CENPA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324761 | Recombinant protein of human centromere protein A (CENPA), transcript variant 1, 20 µg |
CNY 2,900.00 |