p27 KIP 1 (CDKN1B) (NM_004064) Human Mass Spec Standard
CAT#: PH301661
CDKN1B MS Standard C13 and N15-labeled recombinant protein (NP_004055)
View other "p27 KIP 1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDKN1B MS Standard C13 and N15-labeled recombinant protein (NP_004055) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201661 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC201661 representing NM_004064
Red=Cloning site Green=Tags(s) MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004055 |
RefSeq Size | 2422 |
RefSeq ORF | 594 |
Synonyms | CDKN4; KIP1; MEN1B; MEN4; P27KIP1 |
Locus ID | 1027 |
Cytogenetics | 12p13.1 |
Summary | This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Chronic myeloid leukemia, ErbB signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401318 | CDKN1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401318 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B) |
CNY 3,080.00 |
|
TP301661 | Recombinant protein of human cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), 20 µg |
CNY 2,900.00 |
|
TP710154 | Recombinant protein of human cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720258 | Recombinant protein of human cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B) |
CNY 3,140.00 |
其它p27 KIP 1产品