ILF2 (NM_004515) Human Mass Spec Standard
CAT#: PH301751
ILF2 MS Standard C13 and N15-labeled recombinant protein (NP_004506)
View other "ILF2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ILF2 MS Standard C13 and N15-labeled recombinant protein (NP_004506) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201751 |
Predicted MW | 43.1 kDa |
Protein Sequence |
>RC201751 protein sequence
Red=Cloning site Green=Tags(s) MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004506 |
RefSeq Size | 1934 |
RefSeq ORF | 1170 |
Synonyms | NF45; PRO3063 |
Locus ID | 3608 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401437 | ILF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401437 | Transient overexpression lysate of interleukin enhancer binding factor 2, 45kDa (ILF2) |
CNY 3,080.00 |
|
TP301751 | Recombinant protein of human interleukin enhancer binding factor 2, 45kDa (ILF2), 20 µg |
CNY 2,900.00 |