United States
Germany
Japan
United Kingdom
China
Heme oxygenase 2 (HMOX2) (NM_002134) Human Mass Spec Standard
CAT＃: PH301777
HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125)
View other "Heme oxygenase 2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201777 |
| Predicted MW | 36 kDa |
| Protein Sequence |
>RC201777 protein sequence
Red=Cloning site Green=Tags(s) MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002125 |
| RefSeq Size | 1754 |
| RefSeq ORF | 948 |
| Synonyms | HO-2 |
| Locus ID | 3163 |
| Cytogenetics | 16p13.3 |
| Summary | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013] |
| Protein Families | Transmembrane |
| Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419512 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426707 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426708 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426709 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419512 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 3 |
CNY 3,080.00 |
|
| LY426707 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 1 |
CNY 3,080.00 |
|
| LY426708 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 2 |
CNY 3,080.00 |
|
| LY426709 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 4 |
CNY 3,080.00 |
|
| PH325452 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677) |
CNY 14,250.00 |
|
| PH325453 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120678) |
CNY 14,250.00 |
|
| TP301777 | Recombinant protein of human heme oxygenase (decycling) 2 (HMOX2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325452 | Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325453 | Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Heme oxygenase 2产品
