CLIC4 (NM_013943) Human Mass Spec Standard
CAT#: PH301893
CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234)
View other "CLIC4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201893 |
Predicted MW | 28.8 kDa |
Protein Sequence |
>RC201893 protein sequence
Red=Cloning site Green=Tags(s) MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_039234 |
RefSeq Size | 4452 |
RefSeq ORF | 759 |
Synonyms | CLIC4L; H1; huH1; MTCLIC; p64H1 |
Locus ID | 25932 |
Cytogenetics | 1p36.11 |
Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402262 | CLIC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402262 | Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP301893 | Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
|
TP720517 | Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein |
CNY 3,140.00 |