RAB23 (NM_016277) Human Mass Spec Standard
CAT#: PH301922
RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361)
View other "RAB23" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201922 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC201922 protein sequence
Red=Cloning site Green=Tags(s) MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN GGDVINLRPNKQRTKKNRNPFSSCSIP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057361 |
RefSeq Size | 4837 |
RefSeq ORF | 711 |
Synonyms | HSPC137 |
Locus ID | 51715 |
Cytogenetics | 6p12.1-p11.2 |
Summary | This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Hedgehog signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402532 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405187 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402532 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 |
CNY 3,080.00 |
|
LY405187 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 |
CNY 3,080.00 |
|
PH321508 | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050) |
CNY 19,520.00 |
|
TP301922 | Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321508 | Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg |
CNY 2,900.00 |