Calcium binding protein P22 (CHP1) (NM_007236) Human Mass Spec Standard
CAT#: PH301928
CHP MS Standard C13 and N15-labeled recombinant protein (NP_009167)
View other "Calcium binding protein P22" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CHP MS Standard C13 and N15-labeled recombinant protein (NP_009167) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201928 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC201928 protein sequence
Red=Cloning site Green=Tags(s) MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009167 |
RefSeq Size | 3230 |
RefSeq ORF | 585 |
Synonyms | CHP; p22; p24; Sid470p; SLC9A1BP; SPAX9 |
Locus ID | 11261 |
Cytogenetics | 15q15.1 |
Summary | This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402116 | CHP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402116 | Transient overexpression lysate of calcium binding protein P22 (CHP) |
CNY 3,080.00 |
|
TP301928 | Recombinant protein of human calcium binding protein P22 (CHP), 20 µg |
CNY 2,900.00 |
其它Calcium binding protein P22产品