MVK (NM_000431) Human Mass Spec Standard
CAT#: PH301971
MVK MS Standard C13 and N15-labeled recombinant protein (NP_000422)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MVK MS Standard C13 and N15-labeled recombinant protein (NP_000422) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201971 |
Predicted MW | 42.5 kDa |
Protein Sequence |
>RC201971 protein sequence
Red=Cloning site Green=Tags(s) MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARLQSL DTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSICRKQRALPSLDIVVWSELPPG AGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTW GGALRYHQGKISSLKRSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLG EMGEAPAPEQYLVLEELIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQ PEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000422 |
RefSeq Size | 2084 |
RefSeq ORF | 1188 |
Synonyms | LRBP; MK; MVLK; POROK3 |
Locus ID | 4598 |
Cytogenetics | 12q24.11 |
Summary | This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424723 | MVK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426476 | MVK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424723 | Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 1 |
CNY 3,080.00 |
|
LY426476 | Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 2 |
CNY 3,080.00 |
|
PH325616 | MVK MS Standard C13 and N15-labeled recombinant protein (NP_001107657) |
CNY 19,520.00 |
|
TP301971 | Recombinant protein of human mevalonate kinase (MVK), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325616 | Recombinant protein of human mevalonate kinase (MVK), transcript variant 2, 20 µg |
CNY 2,900.00 |