RALB (NM_002881) Human Mass Spec Standard
CAT#: PH301982
RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872)
View other "RALB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201982 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC201982 protein sequence
Red=Cloning site Green=Tags(s) MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002872 |
RefSeq Size | 2275 |
RefSeq ORF | 618 |
Locus ID | 5899 |
Cytogenetics | 2q14.2 |
Summary | This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419049 | RALB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419049 | Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB) |
CNY 3,080.00 |
|
TP301982 | Recombinant protein of human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 20 µg |
CNY 2,900.00 |