AGR2 (NM_006408) Human Mass Spec Standard
CAT#: PH302023
AGR2 MS Standard C13 and N15-labeled recombinant protein (NP_006399)
View other "AGR2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | AGR2 MS Standard C13 and N15-labeled recombinant protein (NP_006399) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202023 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC202023 representing NM_006408
Red=Cloning site Green=Tags(s) MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006399 |
RefSeq Size | 1701 |
RefSeq ORF | 525 |
Synonyms | AG-2; AG2; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; XAG-2 |
Locus ID | 10551 |
Cytogenetics | 7p21.1 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416668 | AGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416668 | Transient overexpression lysate of anterior gradient homolog 2 (Xenopus laevis) (AGR2) |
CNY 3,080.00 |
|
TP302023 | Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2), 20 µg |
CNY 2,900.00 |
|
TP720358 | Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2) |
CNY 3,140.00 |