PDCD6 (NM_013232) Human Mass Spec Standard
CAT#: PH302030
PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364)
View other "PDCD6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202030 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC202030 protein sequence
Red=Cloning site Green=Tags(s) MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037364 |
RefSeq Size | 1151 |
RefSeq ORF | 573 |
Synonyms | ALG-2; ALG2; PEF1B |
Locus ID | 10016 |
Cytogenetics | 5p15.33 |
Summary | This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415726 | PDCD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415726 | Transient overexpression lysate of programmed cell death 6 (PDCD6) |
CNY 3,080.00 |
|
TP302030 | Recombinant protein of human programmed cell death 6 (PDCD6), 20 µg |
CNY 2,900.00 |