PEX5 (NM_000319) Human Mass Spec Standard
CAT#: PH302062
PEX5 MS Standard C13 and N15-labeled recombinant protein (NP_000310)
View other "PEX5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PEX5 MS Standard C13 and N15-labeled recombinant protein (NP_000310) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202062 |
Predicted MW | 69.9 kDa |
Protein Sequence |
>RC202062 protein sequence
Red=Cloning site Green=Tags(s) MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAASKPLGVASEDELVAEFLQDQ NAPLVSRAPQTFKMDDLLAEMQQIEQSNFRQAPQRAPGVADLALSENWAQEFLAAGDAVDVTQDYNETDW SQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKL ANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSA IELQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLF EAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRD WLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLF NLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCIN LGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLP Q SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000310 |
RefSeq Size | 3190 |
RefSeq ORF | 1893 |
Synonyms | PBD2A; PBD2B; PTS1-BP; PTS1R; PXR1; RCDP5 |
Locus ID | 5830 |
Cytogenetics | 12p13.31 |
Summary | The product of this gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424800 | PEX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427361 | PEX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427362 | PEX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424800 | Transient overexpression lysate of peroxisomal biogenesis factor 5 (PEX5), transcript variant 2 |
CNY 3,080.00 |
|
LY427361 | Transient overexpression lysate of peroxisomal biogenesis factor 5 (PEX5), transcript variant 1 |
CNY 3,080.00 |
|
LY427362 | Transient overexpression lysate of peroxisomal biogenesis factor 5 (PEX5), transcript variant 3 |
CNY 3,080.00 |
|
TP302062 | Recombinant protein of human peroxisomal biogenesis factor 5 (PEX5), transcript variant 2, 20 µg |
CNY 2,900.00 |