UGT1A10 (NM_019075) Human Mass Spec Standard
CAT#: PH302144
UGT1A10 MS Standard C13 and N15-labeled recombinant protein (NP_061948)
View other "UGT1A10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UGT1A10 MS Standard C13 and N15-labeled recombinant protein (NP_061948) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202144 |
Predicted MW | 59.8 kDa |
Protein Sequence |
>RC202144 protein sequence
Red=Cloning site Green=Tags(s) MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSL NCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKES SFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNH IVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061948 |
RefSeq Size | 2399 |
RefSeq ORF | 1590 |
Synonyms | GNT1; hUG-BR1; UDPGT; UGT-1A; UGT-1J; UGT1; UGT1-01; UGT1-10; UGT1.1; UGT1.10; UGT1A; UGT1A1; UGT1J |
Locus ID | 54575 |
Cytogenetics | 2q37.1 |
Summary | This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has glucuronidase activity on mycophenolic acid, coumarins, and quinolines. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412759 | UGT1A10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412759 | Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A10 (UGT1A10) |
CNY 3,080.00 |
|
TP302144 | Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A10 (UGT1A10), 20 µg |
CNY 2,900.00 |
其它UGT1A10产品