SNAP29 (NM_004782) Human Mass Spec Standard
CAT#: PH302179
SNAP29 MS Standard C13 and N15-labeled recombinant protein (NP_004773)
View other "SNAP29" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNAP29 MS Standard C13 and N15-labeled recombinant protein (NP_004773) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202179 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC202179 protein sequence
Red=Cloning site Green=Tags(s) MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004773 |
RefSeq Size | 4277 |
RefSeq ORF | 774 |
Synonyms | CEDNIK; SNAP-29 |
Locus ID | 9342 |
Cytogenetics | 22q11.21 |
Summary | This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401502 | SNAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401502 | Transient overexpression lysate of synaptosomal-associated protein, 29kDa (SNAP29) |
CNY 3,080.00 |
|
TP302179 | Recombinant protein of human synaptosomal-associated protein, 29kDa (SNAP29), 20 µg |
CNY 2,900.00 |