STYX (NM_145251) Human Mass Spec Standard
CAT#: PH302205
STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294)
View other "STYX" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202205 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC202205 protein sequence
Red=Cloning site Green=Tags(s) MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED DFGTMQVATAQNG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660294 |
RefSeq Size | 4879 |
RefSeq ORF | 669 |
Locus ID | 6815 |
Cytogenetics | 14q22.1 |
Summary | The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407985 | STYX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427250 | STYX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407985 | Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 1 |
CNY 3,080.00 |
|
LY427250 | Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 2 |
CNY 3,080.00 |
|
PH325273 | STYX MS Standard C13 and N15-labeled recombinant protein (NP_001124173) |
CNY 19,520.00 |
|
TP302205 | Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325273 | Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 2, 20 µg |
CNY 2,900.00 |