ACTR1B (NM_005735) Human Mass Spec Standard
CAT#: PH302493
ACTR1B MS Standard C13 and N15-labeled recombinant protein (NP_005726)
View other "ACTR1B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACTR1B MS Standard C13 and N15-labeled recombinant protein (NP_005726) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202493 |
Predicted MW | 42.3 kDa |
Protein Sequence |
>RC202493 protein sequence
Red=Cloning site Green=Tags(s) MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLT IRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFIS MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAE FEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVA FAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASL DTFKKMWVSKKEYEEDGSRAIHRKTF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005726 |
RefSeq Size | 2258 |
RefSeq ORF | 1128 |
Synonyms | ARP1B; CTRN2; PC3 |
Locus ID | 10120 |
Cytogenetics | 2q11.2 |
Summary | This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq, Aug 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417103 | ACTR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417103 | Transient overexpression lysate of ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) |
CNY 3,080.00 |
|
TP302493 | Recombinant protein of human ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B), 20 µg |
CNY 2,900.00 |