FUS2 (NAT6) (NM_012191) Human Mass Spec Standard
CAT#: PH302498
NAT6 MS Standard C13 and N15-labeled recombinant protein (NP_036323)
View other "FUS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NAT6 MS Standard C13 and N15-labeled recombinant protein (NP_036323) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202498 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC202498 protein sequence
Red=Cloning site Green=Tags(s) MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQ PEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAP VVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGY QLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVP SGPPSKSLLETQYQNVRGRPIFWMEKDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036323 |
RefSeq Size | 1358 |
RefSeq ORF | 924 |
Synonyms | FUS-2; FUS2; HsNAAA80; NAT6 |
Locus ID | 24142 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011] |
Protein Pathways | Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415920 | NAT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415920 | Transient overexpression lysate of N-acetyltransferase 6 (GCN5-related) (NAT6) |
CNY 3,080.00 |
|
TP302498 | Recombinant protein of human N-acetyltransferase 6 (GCN5-related) (NAT6), 20 µg |
CNY 2,900.00 |