COX5B (NM_001862) Human Mass Spec Standard
CAT#: PH302511
COX5B MS Standard C13 and N15-labeled recombinant protein (NP_001853)
View other "COX5B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | COX5B MS Standard C13 and N15-labeled recombinant protein (NP_001853) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202511 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC202511 protein sequence
Red=Cloning site Green=Tags(s) MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA SGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001853 |
RefSeq Size | 523 |
RefSeq ORF | 387 |
Synonyms | COXVB |
Locus ID | 1329 |
Cytogenetics | 2q11.2 |
Summary | Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419690 | COX5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419690 | Transient overexpression lysate of cytochrome c oxidase subunit Vb (COX5B) |
CNY 3,080.00 |
|
TP302511 | Recombinant protein of human cytochrome c oxidase subunit Vb (COX5B), 20 µg |
CNY 2,900.00 |