United States
Germany
Japan
United Kingdom
China
C7orf50 (NM_032350) Human Mass Spec Standard
CAT＃: PH302632
C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_115726)
View other "C7orf50" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_115726) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202632 |
| Predicted MW | 22.1 kDa |
| Protein Sequence |
>RC202632 protein sequence
Red=Cloning site Green=Tags(s) MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115726 |
| RefSeq Size | 1311 |
| RefSeq ORF | 582 |
| Synonyms | YCR016W |
| Locus ID | 84310 |
| Cytogenetics | 7p22.3 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410187 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427414 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427415 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410187 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 1 |
CNY 3,080.00 |
|
| LY427414 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 2 |
CNY 3,080.00 |
|
| LY427415 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 3 |
CNY 3,080.00 |
|
| PH325215 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127867) |
CNY 14,250.00 |
|
| PH325216 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868) |
CNY 19,520.00 |
|
| TP302632 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP325215 | Purified recombinant protein of Homo sapiens chromosome 7 open reading frame 50 (C7orf50), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325216 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它C7orf50产品
